검색어 입력폼

단백질 2차구조 결정 결과

저작시기 2014.10 |등록일 2014.10.29 한글파일한글 (hwp) | 3페이지 | 가격 1,000원

소개글

아미노산 서열이 주어진 경우 프로그램을 통하여 2차구조를 예측한다.

목차

1. 유사 Sequence비교
2. 2차구조 프로그램에 Sequence 입력

본문내용

1. 유사 Sequence비교
-> 제시된 아미노산 서열(1 letter code) : RIPKCRKEFQQAQHLRACQQWLHKQANQSGGGPS

유사한 단백질 : 1SM7, 1PNB

1. 1SM7
Amino acid sequence :
QPQKCQREFQQEQHLRACQQWIRQQLAGSPFSENQWGPQQGPSLREQCCNELYQEDQVEVCPTLKQAAKSVRVQGQHGPFQSTRIYQIAKNLPNVCNMKQIGTCPFIAI

2. 1PNB
Amino acid sequence :
QPQKCQREFQQEQHLRACQQWIRQQLAGSPF

참고 자료

없음
다운로드 맨위로